Cphx1 Rabbit Polyclonal Antibody TA329610 from OriGene Technologies | Biocompare.com

Supplier Images

Cphx1 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Cphx1 Rabbit Polyclonal Antibody

The Cphx1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to cytoplasmic polyadenylated homeobox 1, and Cphx1. This antibody recognizes Mouse antigen. The Cphx1 Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit polyclonal anti-C330003B14RIK antibody

Product Specs
ItemCphx1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA329610
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetCphx1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C330003B14RIK antibody: synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP
NCBI Full Gene Namecytoplasmic polyadenylated homeobox 1
NCBI Gene AliasesCph, Eso-1, Cphx2, Cphx3, 100039280, 100039213, C80129, AU023336, Eso, Gm2135, C330003B14Rik, AU019881, Gm2104, Cphx
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!